Anti-ACCN1

Code: AV35033-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-ACCN1 antibody is suitable for western blot applications at a concentration of 2 µg/ml.

Biochem/physiol Actions

ACCN...


 En savoir plus

Votre prix
$557.33 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-ACCN1 antibody is suitable for western blot applications at a concentration of 2 µg/ml.

Biochem/physiol Actions

ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. ACCN1 gene may modulate the aggressiveness of neuroblastoma tumors.Rabbit Anti-ACCN1 antibody recognizes canine, bovine, human, rat, and mouse ACCN1.

Immunogen

Synthetic peptide directed towards the C terminal region of human ACCN1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ACCN1(40)
mol wt63 kDa
NCBI accession no.NP_001085
Quality Level100
shipped inwet ice
species reactivityrat, dog, human, horse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q16515-2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.