Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-ACCN1 antibody is suitable for western blot applications at a concentration of 2 µg/ml.
Biochem/physiol Actions
ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. ACCN1 gene may modulate the aggressiveness of neuroblastoma tumors.Rabbit Anti-ACCN1 antibody recognizes canine, bovine, human, rat, and mouse ACCN1.
Immunogen
Synthetic peptide directed towards the C terminal region of human ACCN1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :