Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-CHRNA1 is suitable for western blot applications at a concentration of 0.5 µg/ml.
Biochem/physiol Actions
The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
CHRNA1 encodes the α subunit of the muscle acetylcholine receptor and is involved in acetyl choline binding and channel gating functions. The expression of CHRNA1 in thymus tissues is controlled by IRF8 and AIRE. Rabbit Anti-CHRNA1 recognizes mouse, bovine, canine, and human CHRNA1.
Immunogen
Synthetic peptide directed towards the N terminal region of human CHRNA1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :