Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-UHRF2 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml and for IHC (4-8 µg/ml).
Biochem/physiol Actions
UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
UHRF2 is a ubiquitin E3 ligase that also functions as a SUMO E3 ligase for ZNF131. This E3 ligase has been implicated in the cell cycle network.Rabbit Anti-UHRF2 antibody recognizes human, bovine, rat, canine, and mouse UHRF2.
Immunogen
Synthetic peptide directed towards the N terminal region of human UHRF2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :