Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-MEIS2 antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml) applications.
Biochem/physiol Actions
MEIS2 encodes a homeobox protein belonging to the TALE (′three amino acid loop extension′) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
MEIS2 is a homeobox protein that is involved in the development of lens and retina. It is also known to compete with Tle4 for Otx2 binding and modulates tectal fate.Rabbit Anti-MEIS2 antibody recognizes chicken, human, mouse, rat, zebrafish, canine, and bovine MEIS2.
Immunogen
Synthetic peptide directed towards the N terminal region of human MEIS2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :