Anti-RCOR2

Code: AV34671-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-RCOR2 antibody is suitable for western blot applications at a concentration of 1 mg/mL.

Biochem/physiol Actions

RCOR2 may...


 En savoir plus

Votre prix
$456.19 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-RCOR2 antibody is suitable for western blot applications at a concentration of 1 mg/mL.

Biochem/physiol Actions

RCOR2 may act as a component of a corepressor complex that represses transcription.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

RCOR2 is a part of the LSD1 complex and is known to modulate ESC properties. RCOR2 also substitutes for SOX2 during somatic cell reprogramming.Rabbit Anti-RCOR2 antibody recognizes canine, bovine, human, mouse, and rat RCOR2.

Immunogen

Synthetic peptide directed towards the N terminal region of human RCOR2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RCOR2(283248)
mol wt58 kDa
NCBI accession no.NP_775858
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IZ40
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.