Anti-KLHL25

Code: AV34537-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 µg/ml.

Biochem/physiol Actions

KLH...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 µg/ml.

Biochem/physiol Actions

KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1.Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLHL25

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KLHL25(64410)
mol wt66 kDa
NCBI accession no.NP_071925
Quality Level100
shipped inwet ice
species reactivitydog, human, rat, mouse, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9H0H3
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.