Anti-GATA3

Code: AV32548-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit polyclonal anti-GATA3 antibody is used to tag GATA binding protein 3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) tec...


 En savoir plus

Votre prix
$526.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit polyclonal anti-GATA3 antibody is used to tag GATA binding protein 3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GATA binding protein 3 in endothelial and T-cell biology and differentiation.

Rabbit Anti-GATA3 antibody can be used for western blot (0.2-2.0µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions

Trans-acting T-cell specific transcription factor GATA-3 is a member of GATA family of transcription factors that regulates development of multiple tissues. It is an important transcription factor in regulating human Th2 cell differentiation in vivo.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Trans-acting T-cell-specific transcription factor GATA binding protein 3 (GATA3) is a tissue specific transcription factor involved in endothelial cell biology and the regulation of T-cell development. GATA3 plays a role in the development, survival, and function of innate lymphoid cell (ILC) subpopulations. GATA3 differentially regulates T(h)1/T(h)2 differentiation. It promotes the secretion of factors such as IL-4, IL-5 and IL-13 from Th2 cells.

GATA3 facilitates the expression of Th2 gene in CD4+ T cells. Studies in mice have reported that GATA3 disruptions can induce defects in nervous system and fetal liver hematopoiesis.Rabbit Anti-GATA3 antibody recognizes chicken, bovine, canine, pig, human, mouse, and rat GATA3.

Rabbit polyclonal anti-GATA3 antibody reacts with chicken, bovine, canine, pig, human, mouse, and rat GATA binding protein 3 transcription factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human GATA3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GATA3(2625)
mol wt48 kDa
NCBI accession no.NP_002042
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable, immunofluorescence: suitable
UniProt accession no.P23771
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.