Not available outside of the UK & Ireland.
Application
Rabbit Anti-DACH2 antibody can be used for IHC (4-8µg/ml) and western blot (0.5µg/ml) applications.
Biochem/physiol Actions
Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
DACH2 is transcription factor that has an N-terminal DNA binding domain, and a C-terminal protein-binding domain. DACH2 may be implicated in myogenesis, organogenesis and ovarian failure. Rabbit Anti-DACH2 antibody recognizes chicken, human, zebrafish, mouse, and canine DACH2.
Immunogen
Synthetic peptide directed towards the C terminal region of human DACH2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG
This product has met the following criteria to qualify for the following awards: