Anti-NR2F6

Code: AV32256-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-NR2F6 (AB1) antibody can be used for western blot assays at a concentration of 0.1-5.0µg/ml.

Biochem/physiol Actions


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-NR2F6 (AB1) antibody can be used for western blot assays at a concentration of 0.1-5.0µg/ml.

Biochem/physiol Actions

NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NR2F6 is a nuclear receptor that functions as PKC substrate. This receptor is known to regulate the responses of CD4+ T cell activation. Rabbit Anti-NR2F6 (AB1) antibody recognizes canine, human, mouse, and rat NR2F6.

Immunogen

Synthetic peptide directed towards the N terminal region of human NR2F6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NR2F6(2063)
mol wt43 kDa
NCBI accession no.NP_005225
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P10588
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.