Anti-RNF12

Code: AV32151-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-RNF12 antibody can be used for western blot applications at a concentration of 2µg/ml. It can also be used for IHC assays at 4-8µg/ml using ...


 En savoir plus

Votre prix
$526.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-RNF12 antibody can be used for western blot applications at a concentration of 2µg/ml. It can also be used for IHC assays at 4-8µg/ml using paraffin-embedded tissues.

Biochem/physiol Actions

RNF12 is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

RNF12 is known to modulate the inactivation of X chromosome in mouse embryonic stem (ES) cells. RNF12 can target Smad7 for degradation, and regulate the cell fate and morphogenesis in zebrafish embryos.Rabbit Anti-RNF12 antibody recognizes human, canine, mouse, chicken, bovine, and rat RNF12.

Immunogen

Synthetic peptide directed towards the C terminal region of human RNF12

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RNF12(51132)
mol wt69 kDa
NCBI accession no.NP_057204
Quality Level100
shipped inwet ice
species reactivitydog, human, pig, horse, rabbit, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9NVW2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.