Anti-MYF5

Code: AV32134-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-MyF5 antibody can be used for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

MYF5 i...


 En savoir plus

Votre prix
$610.31 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-MyF5 antibody can be used for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

MyF5 (MyoD) regulates the determination of skeletal myoblasts during embryonic development. Inactivation of MyF5 in mice results in abnormal development of the ribs, which eventually leads to perinatal death.Rabbit Anti-MyF5 antibody recognizes chicken, pig, human, mouse, rat, and bovine MyF5.

Immunogen

Synthetic peptide directed towards the N terminal region of human MYF5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MYF5(4617)
mol wt28 kDa
NCBI accession no.NP_005584
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, goat, bovine, rabbit, horse, sheep, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P13349
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.