Anti-FOXO1

Code: AV32107-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-FOXO1 (AB2) antibody can be used for western blot applications at 1µg/ml.

Rabbit polyclonal anti-FOXO1 antibody is used to tag Forkhead box...


 En savoir plus

Votre prix
$511.01 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-FOXO1 (AB2) antibody can be used for western blot applications at 1µg/ml.

Rabbit polyclonal anti-FOXO1 antibody is used to tag Forkhead box O1/forkhead in rhabdomyosarcoma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Forkhead box O1/forkhead in rhabdomyosarcoma in cell differentiation, ESC maintenance and processes such as gluconeogenesis and glycogenolysis.

Biochem/physiol Actions

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Forkhead box O1/forkhead in rhabdomyosarcoma (FOXO1, FKH1, FKHR, FOXO1A), a forkhead transcription factor, is a preadipocye and myogenic differentiation factor and embryonic stem cell (ESC) maintenance factor that regulates gluconeogenesis and glycogenolysis by insulin signaling.

Rabbit polyclonal anti-FOXO1 antibody reacts with bovine, pig, canine, human, mouse, rat, zebrafish, and chicken Forkhead box O1/forkhead in rhabdomyosarcoma transcription factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human FOXO1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESI

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FOXO1(2308)
mol wt70 kDa
NCBI accession no.NP_002006
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, horse, human, guinea pig, dog, mouse, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q12778
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.