Anti-HNF4A

Code: av31946-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-HNF4A antibody can be used for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

The protein ...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-HNF4A antibody can be used for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human HNF4A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HNF4A(3172)
mol wt53 kDa
NCBI accession no.NP_000448
Quality Level100
shipped inwet ice
species reactivityhorse, sheep, rat, guinea pig, human, bovine, dog, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P41235
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.