Anti-C13ORF8

Code: AV31889-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-C13ORF8 antibody can be used for immunohistochemical (4-8µg/ml, using paraffin-embedded tissues) and western blotting (1µg/ml) assays.


 En savoir plus

Votre prix
$456.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-C13ORF8 antibody can be used for immunohistochemical (4-8µg/ml, using paraffin-embedded tissues) and western blotting (1µg/ml) assays.

Biochem/physiol Actions

The function of the C13orf8 gene has not yet been determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

C13ORF8 (CAMP, ZNF828) is a zinc finger protein that has FPE, SPE and WK motifs. This protein is known to regulate kinetochore-microtubule attachment during bi-orientation.Rabbit Anti-C13ORF8 antibody recognizes human C13ORF8.

Immunogen

Synthetic peptide directed towards the middle region of human C13ORF8

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... C13ORF8(283489)
mol wt89 kDa
NCBI accession no.NP_115812
Quality Level100
shipped inwet ice
species reactivityhorse, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q96JM3
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.