Anti-YEATS4

Code: av30118-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-YEATS4 antibody can be used for western blot (0.5µg/ml) and immunohistochemistry (4-8µg/ml, using paraffin-embedded tissues) assays.

<...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-YEATS4 antibody can be used for western blot (0.5µg/ml) and immunohistochemistry (4-8µg/ml, using paraffin-embedded tissues) assays.

Biochem/physiol Actions

YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

YEATS4 is an oncogene that negatively regulates the p21-p53 pathway. Amplification of YEATS4 has been linked to the pathogenesis of non-small cell lung cancers (NSCLC).Rabbit Anti-YEATS4 antibody recognizes chicken, bovine, zebrafish, canine, human, mouse, and rat YEATS4.

Immunogen

Synthetic peptide directed towards the middle region of human YEATS4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... YEATS4(8089)
mol wt25 kDa
NCBI accession no.NP_006521
Quality Level100
shipped inwet ice
species reactivityrat, horse, guinea pig, mouse, dog, rabbit, bovine, sheep, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O95619
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.