Anti-TAL1

Code: AV100970-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-TAL1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5 µg/ml. For immunohistochemistry of paraffin-embedded tis...


 En savoir plus

Votre prix
$635.85 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-TAL1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.

Biochem/physiol Actions

TAL1/SCL regulates osteoclast-differentiation via GATA-2, macrophage colony-stimulating factor, and osteoclast-differentiation factor/osteoprotegerin ligand pathway.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TAL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TAL1(6886)
mol wt34 kDa
NCBI accession no.NP_003180
Quality Level100
shipped inwet ice
species reactivitybovine, mouse, human, dog, guinea pig, rat, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P17542
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.