Anti-TRIM22

Code: AV100888-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

TRIM22 exerts anti-viral activity against RNA viruses and is stimulated by interferon-α. It restricts the replication of influenza A virus by interact...


 En savoir plus

Votre prix
$635.85 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

TRIM22 exerts anti-viral activity against RNA viruses and is stimulated by interferon-α. It restricts the replication of influenza A virus by interacting with viral nucleoprotein followed by ubiquitination and proteasome-dependent degradation. TRIM22 also restricts the replication of encephalomyocarditis virus (EMCV), hepatitis B virus (HBV), and human immunodeficiency virus type 1 (HIV-1). It has been implicated in cellular differentiation and proliferation of certain cancers and autoimmune reactions.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRIM22

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQ

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TRIM22(10346)
mol wt57 kDa
NCBI accession no.NP_006065
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IYM9
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.