Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti- BCL2A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.
Biochem/physiol Actions
The expression of BCL2A1 protein is regulated by NF-κB transcription factor. It has prosurvival and metastatic effects and facilitates survival of leukocytes subsets and inflammation. It is upregulated in melanomas and chronic inflammatory diseases.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
BCL2 proteins are important regulators of cell death and survival. They are recognized as cellular oncogenes that are often deregulated in cancers.
Immunogen
Synthetic peptide directed towards the C terminal region of human BCL2A1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :