Anti-RGS3

Code: AV09007-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 µg/ml.

Biochem/physiol Actions


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 µg/ml.

Biochem/physiol Actions

Regulator of G-protein signaling-3 (RGS3) accelerates the GTPase activity of G(i) and G(q) subunits. It interacts with the Smad transcription factors that are activated by TGF-β and prevents the heteromerization of Smad3 and Smad4. This results in inhibition of transcriptional activity of Smads and inhibition of TGF-β-induced differentiation of myofibroblasts. In sensory neurons, RGS3 mediates the termination of G protein signaling by calcium influx through voltage-gated channels. The role of RGS3 in collaboration with Ephrin-B is important in the maintenance of the neural progenitor cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human RGS3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RGS3(5998)
mol wt101 kDa
NCBI accession no.NP_066929
Quality Level100
shipped inwet ice
species reactivitymouse, bovine, human, dog, rat, pig, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P49796
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.