Not available outside of the UK & Ireland.
Application
Anti-CMKLR1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.
Biochem/physiol Actions
CMKLR1 is a G-protein coupled receptor that is activated by chemerine, a leukocyte attractant and adipokine. CMKLR1 is expressed in embryonic and adult skeletal muscle, though its role in adults is not clear. It regulates the processes of cell migration and differentiation of myoblasts into myotubes. The role of this receptor is important in adipose tissue development, inflammation, and glucose homeostasis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human CMKLR1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
This product has met the following criteria to qualify for the following awards: