Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.
Biochem/physiol Actions
CXCL3 is a chemokine that binds to CXCR1 and CXCR2 receptors and stimulates p38 and ERK1/2-dependent migration of asthmatic airway smooth muscle cells. Prostate stromal cells secrete CXCL3 in response to IL-1 that results in prostatic inflammation in early stages of prostate cancer formation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human CXCL3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Target description
CXCL3 is a chemokine that affects migration and adhesion of monocytes. CXCR2 is its known receptor.
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :