Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-TNFSF10 antibody can be used for western blot assays at 1.0µg/ml.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TNFSF10 (TRAIL) is a p53 target gene that regulates p53-dependent apoptosis.Rabbit Anti-TNFSF10 antibody binds to human, canine, and pig TNFSF10.
Immunogen
Synthetic peptide directed towards the N terminal region of human TNFSF10
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :