SILU(TM) PROT APOD

Code: msst0061-10ug D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is main...


 Read more

Your Price
$824.06 10UG

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

General description

SILuProt APOD is a recombinant, stable isotope-labeled human APOD which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of APOD in mass-spectrometry. SILuProt APOD is a protein of 189 amino acids (including a C-terminal polyhistidine and tag), with a calculated molecular mass of 21.8 kDa.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Sequence

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

assay≥95% (SDS-PAGE)
formlyophilized powder
Gene Informationhuman ... APOD(347)
potency≥98% (Heavy amino acids incorporation efficiency by MS)
Quality Level200
recombinantexpressed in HEK 293 cells
shipped inambient
storage temp.−20°C
suitabilitysuitable for mass spectrometry (standard)
UniProt accession no.P05090
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.