SILU(TM)PROT TIMP2 METALLOPROTEINASE

Code: msst0045-10ug D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs),...


 Read more

Your Price
$1,199.12 10UG

Not available outside of the UK & Ireland.

Biochem/physiol Actions

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.

General description

SILuProt TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILuProt TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

assay≥98% (SDS-PAGE)
formlyophilized powder
potency≥98% Heavy amino acids incorporation efficiency by MS
Quality Level200
recombinantexpressed in HEK 293 cells
storage temp.−20°C
suitabilitysuitable for mass spectrometry (standard)
UniProt accession no.P16035
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.