Not available outside of the UK & Ireland.
Biochem/physiol Actions
B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).
General description
SILu™ Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu™ Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa. Suggested Quantitative Analysis Parameters (MRM settings provided for three suggested peptides)
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Sequence
IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ
This product has met the following criteria to qualify for the following awards: