ANTI-MRGPRX1 (C-TERMINAL) ANTIBODY PRODU

Code: sab2109129-100ul D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$419.42 100UL

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

MRGPRX1 is an orphan receptor. MRGPRX1 is probably involved in the function of nociceptive neurons. It may regulate nociceptor function and/or development, including the sensation or modulation of pain. MRGPRX1 is potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. MRGPRX1 is activated by the antimalarial drug, chloroquine and may mediate chloroquine-induced itch, in an histamine-independent manner.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human MRGPRX1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MRGPRX1(57396)
mol wt36 kDa
NCBI accession no.NM_147199
shipped inwet ice
species reactivity (predicted by homology)human
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.