ANTI-HMOX1

Code: sab2108676-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subseque...


 Read more

Your Price
$517.56 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human HMOX1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM

accession no.NM_002133
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HMOX1(3162)
mol wt33 kDa
Quality Level100
shipped inwet ice
species reactivitybovine, goat, human, mouse, rat, dog, rabbit, pig
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.P09601
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.