ANTI-PCNA

Code: sab2108448-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-PCNA has been used in:immunoblot (1:500) (1:1,000) (1:750)far-western analysis (1:1000)immunohistochemistry (1?:?50) (1:1000)proliferating cell nuclear antig...


 Read more

Your Price
$537.72 100UL

Not available outside of the UK & Ireland.

Application

Anti-PCNA has been used in:immunoblot (1:500) (1:1,000) (1:750)far-western analysis (1:1000)immunohistochemistry (1?:?50) (1:1000)proliferating cell nuclear antigen (PCNA) overlay assay (1:1,000)

Biochem/physiol Actions

Proliferating cell nuclear antigen (PCNA) participates in DNA replication and repair. It acts as an auxiliary factor of polymerase δ. It plays a key role in the maturation of Okazaki fragments. It can be used as a prognostic and diagnostic marker in chronic lymphoid leukemia (CLL). High expression of PCNA protein is seen in breast and duodenal cancers.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Proliferating cell nuclear antigen (PCNA), a nuclear protein, is expressed ubiquitously in mammals. This homotrimer protein is a doughnut-shaped molecule that is expressed at high levels in the thymus, bone marrow, fetal liver, and few cells of the small intestine and colon. PCNA is mainly located in the nucleus. The PCNA gene is a single-copy gene mapped to human chromosome 20p13.

Immunogen

Synthetic peptide directed towards the C terminal region of human PCNA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

accession no.NM_002592
antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PCNA(5111)
mol wt29 kDa
Quality Level100
shipped inwet ice
species reactivityrat, human, mouse, bovine, dog
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.P12004
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.