Not available outside of the UK & Ireland.
Biochem/physiol Actions
The paired-like homeodomain transcription factor 3 (PITX3) participates in the midbrain dopamine system development. The homeodomain of PITX3 is essential for DNA binding. Single-nucleotide polymorphism in this gene is linked with Parkinson′s disease.Members of RIEG/PITX homeobox family act as transcription factors. Mutations of PITX3 have been associated with anterior segment mesenchymal dysgenesis (ASMD) and congenital cataracts. PITX3 is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
The paired-like homeodomain transcription factor 3 (PITX3) is located on human chromosome 10q24. It has a characteristic homeodomain. PITX3 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human PITX3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG
This product has met the following criteria to qualify for the following awards: