ANTI-SLC22A8

Code: sab2108219-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral m...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SLC22A8

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC22A8(9376)
mol wt60kDa
NCBI accession no.NM_004254
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.Q8TCC7
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.