Anti-ATP6V1C1

Code: sab2103297-100ul D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

ATP6V1C1 (ATPase H+ transporting V1 subunit C1) is overexpressed in breast cancer, where it modulates the actin structure in a way that it ...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

ATP6V1C1 (ATPase H+ transporting V1 subunit C1) is overexpressed in breast cancer, where it modulates the actin structure in a way that it promotes metastasis. This gene is up-regulated in oral squamous cell carcinoma (OSCC).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ATP6V1C1 (ATPase H+ transporting V1 subunit C1) is a subunit and regulator of V-ATPase (vacuolar ATPase).

Immunogen

Synthetic peptide directed towards the N terminal region of human ATP6V1C1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ATP6V1C1(528)
mol wt42 kDa
NCBI accession no.NM_001695
Quality Level100
shipped inwet ice
species reactivityhuman, rat, bovine, dog, mouse, rabbit, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P21283
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.