Not available outside of the UK & Ireland.
Application
Anti-FAU antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
FAU (FBR-MuSV associated ubiquitously expressed gene) gene is the cellular counterpart of the fox sequence present in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). FAU gene is mapped on to chromosome 11 at 11q13 and is ubiquitously expressed. It encodes a fusion protein comprising ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. Fubi belongs to ubiquitin family whereas ribosomal protein S30 is a member of S30E family of ribosomal proteins. S30 is a component of 40S ribosomal subunit and facilitates the antimicrobial activity. FAU gene is a pro-apoptotic regulatory gene that augments basal apoptosis in human T-cell lines and 293T/17 cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human FAU
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
This product has met the following criteria to qualify for the following awards: