Anti-ZNHIT3

Code: av50503-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-ZNHIT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-ZNHIT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Zinc finger, HIT-type containing 3 (ZNHIT3) is a nuclear receptor interacting protein that interacts with peroxisome proliferator-activated receptor γ (PPARγ) and regulates development and homeostasis. ZNHIT3 may regulate the transcription activity of hepatocyte nuclear factor-4α and may be involved in glucose metabolism.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNHIT3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZNHIT3(9326)
mol wt17 kDa
NCBI accession no.NP_004764
Quality Level100
shipped inwet ice
species reactivitypig, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q15649
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.