Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-MAP3K1 antibody is suitable for western blot applications at a concentration of 1µg/ml.
Biochem/physiol Actions
MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-983 AC008937.7 118022-119004 c 984-1536 AF042838.1 426-978 1537-1653 AC008937.7 68621-68737 c 1654-1802 AC008937.7 68100-68248 c 1803-2870 AF042838.1 1245-2312 2871-4167 AC008937.7 51211-52507 c 4168-4758 BU194120.1 127-717 4759-5154 DA889202.1 164-559 5155-7355 AC008937.7 38082-40282 c 7356-7522 AA602425.1 1-167 c
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin (MAP3K1) is a serine/threonine kinase that regulates cell signaling. It interacts with Axin1 and is involved in Wnt signaling. Genetic variations in MAP3K1 have been linked to breast cancer risk and sex development disorders.Rabbit Anti-MAP3K1 antibody recognizes human, mouse, rat, bovine, and rabbit MAP3K1.
Immunogen
Synthetic peptide directed towards the C terminal region of human MAP3K1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :