Anti-STRAP

Code: av48038-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-STRAP antibody is suitable for IHC applications at a dilution of 1:150 and for western blot applications at a concentration of 0.5μg/ml.


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-STRAP antibody is suitable for IHC applications at a dilution of 1:150 and for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Serine/threonine kinase receptor associated protein (STRAP) is a poly(A) RNA binding protein that modulates type I collagen mRNA translation. It decreases the ubiquitination of Notch3 and negatively regulates ASK1.Rabbit Anti-STRAP antibody recognizes human, mouse, rat, canine, bovine, and zebrafish STRAP.

Immunogen

Synthetic peptide directed towards the N terminal region of human STRAP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... STRAP(11171)
mol wt38 kDa
NCBI accession no.NP_009109
Quality Level100
shipped inwet ice
species reactivityguinea pig, dog, mouse, rat, rabbit, bovine, human, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9Y3F4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.