Anti-MPG

Code: av44694-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-MPG antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

N-...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Anti-MPG antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

N-methylpurine-DNA glycosylase (MPG) is an enzyme that repairs the genome-wide damage caused by alkylating agents. MPG repairs the hypoxanthine that is formed by the deamination of adenine and 1,N6-ethenoadenine formed as a result of interaction of lipid peroxidation-derived aldehydes and hydroxyalkenals with DNA. A functional linkage between MPG and p53; MPG acting as the selective regulator of p53-mediated cell cycle arrest.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human MPG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MPG(4350)
mol wt32 kDa
NCBI accession no.NP_001015052
Quality Level100
shipped inwet ice
species reactivitymouse, rat, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q5J9I4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.