Anti-SLC25A38

Code: av43978-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-SLC25A38 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25µg/ml and for immunohistochemistry of paraffin-embedded ...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-SLC25A38 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.

Biochem/physiol Actions

SLC25A38 belongs to the mitochondrial carrier family and is essential for the biosynthesis of heme during erythropoiesis. Mutations in the gene encoding this carrier protein result in erythroblast mitochondrial iron overload, characteristic of congenital sideroblastic anemias. SLC25A38 is overexpressed in acute lymphoblastic lymphoma and may be considered as a diagnostic marker.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SLC25A38

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC25A38(54977)
mol wt33 kDa
NCBI accession no.NP_060345
Quality Level100
shipped inwet ice
species reactivityhorse, human, bovine, pig, mouse, rabbit, rat, dog, sheep
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q96DW6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.