Anti-AKR1B10

Code: av42553-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-AKR1B10 polyclonal antibody is used to tag advanced AKR1B10 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohis...


 Read more

Your Price
$538.48 100UL

Not available outside of the UK & Ireland.

Application

Anti-AKR1B10 polyclonal antibody is used to tag advanced AKR1B10 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a potential tumor marker for pancreatic and lung cancer.

Biochem/physiol Actions

AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Aldo-keto reductase family 1B10 (AKR1B10) exhibits restricted lipid substrate specificity including farnesal, geranylgeranial, retinal and carbonyls; wherein metabolizing these lipid substrates has a crucial role in promoting carcinogenesis. AKR1B10 and 1B12 display high catalytic efficiency with all-trans-retinaldehyde. Aldo-keto reductase 1B10 (AKR1B10) is a secretory protein that is upregulated with tumorigenic transformation of human mammary epithelial cells. It is a tumor marker for cancers such as pancreatic cancer, lung carcinomas.

Immunogen

Synthetic peptide directed towards the N terminal region of human AKR1B10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Specificity

Anti-AKR1B10 polyclonal antibody reacts with human, mouse, rat, and zebrafish aldo-keto reductase family 1, member B10 (aldose reductase) enzymes..

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... AKR1B10(57016)
mol wt35 kDa
NCBI accession no.NP_064695
Quality Level100
shipped inwet ice
species reactivitydog, rabbit, mouse, human, horse, yeast
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O60218
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.