Not available outside of the UK & Ireland.
Application
Anti-NOVA1 antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
NOVA1 (Neuro-oncological ventral antigen 1) is associated with several post-transcriptional regulation of RNA metabolism including RNA splicing, editing to transport, localization, and degradation. It may be involved in mediating neuronal responsiveness. It encodes a protein which has homology with the RNA-binding protein hnRNP K, the yeast splicing protein MER1. Since, it has some homology with hnRNP K, it may influence the regulation of RNA splicing or metabolism in developing neurons. The importance of NOVA1 as prognostic marker has been reported in HCC (Hepatocellular carcinoma). Alteration in gene causes a disorder associated with breast cancer and motor dysfunction i.e. paraneoplastic opsoclonus myoclonus ataxia (POMA).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
NOVA1 (Neuro-oncological ventral antigen 1) is a neuron-specific nuclear RNA-binding protein expressed in brain, specifically in hippocampus, hypothalamus, cingulate cortex, and medial habenular nucleus.
Immunogen
Synthetic peptide directed towards the C terminal region of human NOVA1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
This product has met the following criteria to qualify for the following awards: