Anti-NRF1

Code: av38543-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-NRF1 polyclonal antibody is used to tag nuclear respiratory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistoc...


 Read more

Your Price
$538.48 100UL

Not available outside of the UK & Ireland.

Application

Anti-NRF1 polyclonal antibody is used to tag nuclear respiratory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of nuclear respiratory factor 1 in respiratory and antioxidation processes and nuclear, mitochondrial biogenomic coordination.

Biochem/physiol Actions

NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Nuclear respiratory factor 1 (NRF1) is a transcription factor that activates cassettes of metabolic genes that regulate cellular respiratory and oxidative stress genes involved in heme biosynthesis, mitochondrial DNA transcription and replication and antioxidant enzymes. NRF1 and NRF2 function to mediate biogenomic coordination between nuclear and mitochondrial genomes.

Immunogen

Synthetic peptide directed towards the C terminal region of human NRF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY

Specificity

Anti-NRF1 polyclonal antibody reacts with human nuclear respiratory factor 1.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NRF1(4899)
mol wt56 kDa
NCBI accession no.NP_001035199
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q96AN2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.