Anti-FREQ

Code: av34315-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-FREQ antibody is suitable for western blot (0.5 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

<...


 Read more

Your Price
$459.05 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-FREQ antibody is suitable for western blot (0.5 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

FREQ is a member of the neuronal calcium sensor gene family, which encode calcium-binding proteins expressed predominantly in neurons. The protein encoded by this gene regulates G protein-coupled receptor phosphorylation in a calcium-dependent manner and can substitute for calmodulin. This protein is thought to be associated with secretory granules and may be involved in the regulation of neurosecretion.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

FREQ (NCS1) is a neuronal calcium sensor that modulates G protein-coupled receptor (GPCR) phosphorylation and synaptic functions. Interaction between variation in the DRD2 and FREQ genes can be used to predict the efficacy of nicotine replacement therapy. Rabbit Anti-FREQ antibody recognizes bovine, human, mouse, rat, chicken, zebrafish FREQ.

Immunogen

Synthetic peptide directed towards the N terminal region of human FREQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FREQ(23413)
mol wt22 kDa
NCBI accession no.NP_055101
Quality Level100
shipped inwet ice
species reactivityhuman, bovine, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P62166
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.