Anti-NFATC4

Code: av32715-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-NFATC4 antibody can be used for western blot (1.25µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions

...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-NFATC4 antibody can be used for western blot (1.25µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions

NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NFATC4 forms a part of a DNA-binding transcription complex that consists of inducible cytosolic and nuclear components. NFATC4 is involved in modulating neurotrophin-mediated synaptic plasticity and can also induce interleukins 2 and 4. p38 Mitogen-activated protein (MAP) kinases can regulate NFATC4 phosphorylation.Rabbit Anti-NFATC4 antibody recognizes canine, bovine, human, mouse, and rat NFATC4.

Immunogen

Synthetic peptide directed towards the middle region of human NFATC4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NFATC4(4776)
mol wt95 kDa
NCBI accession no.NP_001129494
Quality Level100
shipped inwet ice
species reactivityrat, human, bovine, rabbit, mouse, guinea pig, dog, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q14934
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.