Anti-ZNF318

Code: av32523-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-ZNF318 can be used for IHC (4-8µg/ml) and western blot (0.5µg/ml) applications.

Biochem/physiol Actions

ZNF318 ...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-ZNF318 can be used for IHC (4-8µg/ml) and western blot (0.5µg/ml) applications.

Biochem/physiol Actions

ZNF318 encodes a nuclear protein with a zinc finger motif of the Cys2-His2 type that is a novel corepressor of androgen receptor (AR).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF318 is a zinc-finger protein that is upregulated during respiratory syncytial virus (RSV) infection in pharyngeal cells.Rabbit Anti-ZNF318 recognizes mouse, canine, and human ZNF318.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF318

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZNF318(24149)
mol wt232 kDa
NCBI accession no.NP_055160
Quality Level100
shipped inwet ice
species reactivityguinea pig, human, rat, mouse, horse, dog, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q5VUA4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.