Anti-DACH2

Code: av32425-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-DACH2 antibody can be used for IHC (4-8µg/ml) and western blot (0.5µg/ml) applications.

Biochem/physiol Actions


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-DACH2 antibody can be used for IHC (4-8µg/ml) and western blot (0.5µg/ml) applications.

Biochem/physiol Actions

Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

DACH2 is transcription factor that has an N-terminal DNA binding domain, and a C-terminal protein-binding domain. DACH2 may be implicated in myogenesis, organogenesis and ovarian failure. Rabbit Anti-DACH2 antibody recognizes chicken, human, zebrafish, mouse, and canine DACH2.

Immunogen

Synthetic peptide directed towards the C terminal region of human DACH2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DACH2(117154)
mol wt65 kDa
NCBI accession no.NP_444511
Quality Level100
shipped inwet ice
species reactivitymouse, rabbit, rat, human, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q96NX9
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.