Anti-CHRNB2

Code: av13020-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-CHRNB2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
$610.31 100UL

Not available outside of the UK & Ireland.

Application

Anti-CHRNB2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Biochem/physiol Actions

CHRNB2 is a transmembrane, oligomeric, ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. Mutations in gene that codes for CHRNB2 have been observed in autosomal dominant nocturnal frontal lobe epilepsy and memory deficits.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CHRNB2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CHRNB2(1141)
mol wt57 kDa
NCBI accession no.NP_000739
Quality Level100
shipped inwet ice
species reactivitymouse, dog, pig, bovine, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P17787
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.