Not available outside of the UK & Ireland.
Application
Anti-SLC39A6 polyclonal antibody is used to tag solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 in intracellular zinc homeostasis, epithelial-to-mesenchymal transition (EMT) in cancer cells, and in HDACi-induced apoptosis.
Biochem/physiol Actions
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 (SLC39A6, LIV1, ZIP6) is a mediator of zinc (Zn2+) transport and intracellular zinc homeostasis. SLC39A6/LIV1 is involves in important processes such as epithelial-to-mesenchymal transition (EMT) in human pancreatic, breast, and prostate cancer cells. SLC39A6/LIV1 has been shown to be a critical mediator responsible for HDACi-induced apoptosis.
Immunogen
Synthetic peptide directed towards the middle region of human SLC39A6
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
Specificity
Anti-SLC39A6 polyclonal antibody reacts with bovine, canine, human, mouse, and rat solute carrier family 39 (Zinc transporter), member 6 proteins.
This product has met the following criteria to qualify for the following awards: