Anti-MLL4

Code: AV33704-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

MLL4 a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of var...


 Read more

Your Price
$538.48 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

MLL4 a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. MLL4 is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Myeloid/lymphoid or mixed-lineage leukemia 4 (MLL4) is a histone-lysine N-methyltransferase widely expressed in the nucleus of multiple cell types. It contains a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET domain.

Immunogen

Synthetic peptide directed towards the N terminal region of human MLL4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MLL4(9757)
mol wt64 kDa
NCBI accession no.NP_055542
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UMN6-2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.