Anti-MYBL1

Code: av32707-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit polyclonal anti-MyBL1 antibody is used to tag v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 for detection and quantitation by immunocytochemic...


 Read more

Your Price
$538.48 100UL

Not available outside of the UK & Ireland.

Application

Rabbit polyclonal anti-MyBL1 antibody is used to tag v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 in spermatocyte development.

Rabbit Anti-MyBL1 antibody can be used for IHC (4-8µg/ml) and western blot (2.5µg/ml) applications.

Biochem/physiol Actions

MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Rabbit polyclonal anti-MyBL1 antibody reacts with chicken, canine, human, mouse, and rat v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 transcription factors.

v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 (MyBL1) which is expressed predominantly as a tissue-specific transcription factor in spermatocytes and breast epithelial cells is a male-specific regulator of several crucial meiotic processes. MYBL1 is a master regulator of meiotic genes that are involved in multiple processes in spermatocytes, particularly those required for cell cycle progression through pachynema. MYBL1 directs germ cell-specific activation via the CRE site of certain genes.

Immunogen

Synthetic peptide directed towards the middle region of human MYBL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MYBL1(4603)
mol wt49 kDa
NCBI accession no.NP_001073885
Quality Level100
shipped inwet ice
species reactivityrat, guinea pig, dog, horse, human, bovine, rabbit, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P10243
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.