Anti-HOXA10

Code: AV100932-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit polyclonal anti-HOXA10 antibody is used to tag homeobox A10 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. ...


 Read more

Your Price
$416.73 100UL

Not available outside of the UK & Ireland.

Application

Rabbit polyclonal anti-HOXA10 antibody is used to tag homeobox A10 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of homeobox A10 in hematopoiesis involving the expansion of myeloid progenitor populations and the development of acute myeloid leukemia (AML). Anti-HOXA10 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

HOXA10 is an important regulator of embryogenesis and lineage determination of hematopoietic progenitor cells. In primates, HOXA10 maintains uterine homeosis to regulate receptivity and implantation by synchronizing the maternal and embryonic signaling on the endometrial cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Rabbit polyclonal anti-HOXA10 antibody reacts with rabbit, pig, canine, mouse, bovine, human, and rat homeobox A10 transcription factors.

Homeobox A10 (HOXA10) is a homeodomain transcription factor involved in definitive hematopoiesis and implicated in the pathogenesis of acute myeloid leukemia (AML). HOXA10 facilitates myeloid progenitor expansion/proliferation while impeding myeloid differentiation. Sustained HoxA10expression during differentiation has been described in poor prognosis human acute myeloid leukemia (AML).

Immunogen

Synthetic peptide directed towards the N terminal region of human HOXA10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HOXA10(3206)
mol wt41 kDa
NCBI accession no.NP_714926
Quality Level100
shipped inwet ice
species reactivitydog, bovine, pig, rabbit, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P31260
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.