ANTI-WT1

Code: sab2108752-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-termin...


 En savoir plus

Votre prix
$517.56 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.

Immunogen

Synthetic peptide directed towards the middle region of human WT1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

accession no.NM_024424
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... WT1(7490)
mol wt56 kDa
Quality Level100
shipped inwet ice
species reactivityrabbit, mouse, human, rat, dog
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.P19544
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.